Structure of PDB 5mps Chain e

Receptor sequence
>5mpse (length=75) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVE
IPVNSKGTPLGKILLKGDNITLITS
3D structure
PDB5mps Structure of a spliceosome remodelled for exon ligation.
Chaine
Resolution3.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e F49 M50 D85 F40 M41 D68
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:1990935 splicing factor binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000387 spliceosomal snRNP assembly
GO:0000395 mRNA 5'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0036261 7-methylguanosine cap hypermethylation
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005685 U1 snRNP
GO:0005686 U2 snRNP
GO:0005687 U4 snRNP
GO:0005737 cytoplasm
GO:0032991 protein-containing complex
GO:0034715 pICln-Sm protein complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071001 U4/U6 snRNP
GO:0071004 U2-type prespliceosome
GO:0071011 precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mps, PDBe:5mps, PDBj:5mps
PDBsum5mps
PubMed28076345
UniProtQ12330|RUXE_YEAST Small nuclear ribonucleoprotein E (Gene Name=SME1)

[Back to BioLiP]