Structure of PDB 5imr Chain e

Receptor sequence

>5imre (length=174) Species: 300852 (Thermus thermophilus HB8)

IGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVE
RPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRAL
ELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRK
PSAYHEKGIYYAGEPVRLKPGKAG

3D structure

• PDB: 5imr Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome
• Chain: e
• Resolution: 5.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e	I4 R6 R59 K62 S63 G66 L67 T70 G108 F109 S110 K138 Q139 G142 Q143 R152 H158 K160 G174 K175	I1 R3 R56 K59 S60 G63 L64 T67 G105 F106 S107 K135 Q136 G139 Q140 R149 H155 K157 G171 K172

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 02:50:20 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5imr', asym_id = 'e', title = 'Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5imr', asym_id='e', title='Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '5imr', asym_id = 'e'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='5imr', asym_id='e')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>