Structure of PDB 5imq Chain e

Receptor sequence
>5imqe (length=174) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
IGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVE
RPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRAL
ELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRK
PSAYHEKGIYYAGEPVRLKPGKAG
3D structure
PDB5imq Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome
Chaine
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e R6 R59 S63 G66 L67 T70 K138 Q139 G142 Q143 R152 H158 K160 K172 K175 R3 R56 S60 G63 L64 T67 K135 Q136 G139 Q140 R149 H155 K157 K169 K172
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Nov 24 16:55:40 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5imq', asym_id = 'e', title = 'Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5imq', asym_id='e', title='Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '5imq', asym_id = 'e'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='5imq', asym_id='e')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>