Structure of PDB 5afi Chain e
Receptor sequence
| >5afie (length=157) Species: 562 (Escherichia coli) [Search protein sequence] |
| ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAA IQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGG AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGK SVEEILG |
3D structure
| PDB | 5afi Structure of the E. coli ribosome-EF-Tu complex at <3 angstrom resolution by Cs-corrected cryo-EM. | ||
| Chain | e | ||
| Resolution | 2.9 Å | ||
| 3D structure |
|
Enzymatic activity
| Enzyme Commision number | ? |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | rna | e | V20 S21 K22 T23 V24 K25 G26 R28 Y49 K51 K61 T89 F94 Q96 A98 S99 E100 G101 A106 G107 L123 K125 A126 Y127 S129 T130 N131 N134 R137 | V12 S13 K14 T15 V16 K17 G18 R20 Y41 K43 K53 T81 F86 Q88 A90 S91 E92 G93 A98 G99 L115 K117 A118 Y119 S121 T122 N123 N126 R129 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0003723 | RNA binding |
| GO:0003735 | structural constituent of ribosome |
| GO:0005515 | protein binding |
| GO:0019843 | rRNA binding |
