Structure of PDB 4v4j Chain e

Receptor sequence

>4v4je (length=208) Species: 262724 (Thermus thermophilus HB27)

GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRP
SDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRL
DNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEK
SRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ
LVIEFYSR

3D structure

• PDB: 4v4j Interactions and dynamics of the Shine Dalgarno helix in the 70S ribosome.
• Chain: e
• Resolution: 3.83 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e	G2 R3 I5 P7 R10 K22 G23 E24 R25 K30 Y38 Q42 H43 Y54 A55 R66 E72 R73 Q74 S83 K85 K86 R115 Q116 R118 Q119 R122 H123 R132 D134 L135 S137 Y138 K151	G1 R2 I4 P6 R9 K21 G22 E23 R24 K29 Y37 Q41 H42 Y53 A54 R65 E71 R72 Q73 S82 K84 K85 R114 Q115 R117 Q118 R121 H122 R131 D133 L134 S136 Y137 K150

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v4j, PDBe:4v4j, PDBj:4v4j
• PDBsum: 4v4j
• PubMed: 17940016
• UniProt: P80373|RS4_THET8 Small ribosomal subunit protein uS4 (Gene Name=rpsD)