Structure of PDB 3jcu Chain e

Receptor sequence
>3jcue (length=79) Species: 3562 (Spinacia oleracea) [Search protein sequence]
STGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPN
EYFTESRQGIPLITGRFDSLEQLDEFSRS
3D structure
PDB3jcu Structure of spinach photosystem II-LHCII supercomplex at 3.2 A resolution
Chaine
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide e T67 F70 D71 T64 F67 D68
BS02 HEM e I13 R18 Y19 I22 H23 I27 L30 I10 R15 Y16 I19 H20 I24 L27
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009536 plastid
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jcu, PDBe:3jcu, PDBj:3jcu
PDBsum3jcu
PubMed27251276
UniProtP69383|PSBE_SPIOL Cytochrome b559 subunit alpha (Gene Name=psbE)

[Back to BioLiP]