Structure of PDB 3jb9 Chain e

Receptor sequence

>3jb9e (length=144) Species: 284812 (Schizosaccharomyces pombe 972h-)

RLRTSRTKRPPDGFDEIEPTLIEFQDRMRQIENTMGKGTKTEMLAPIFQL
HHQRSRYIYDLYYKREAISTELYNWLLKQNYADGNLIAKWKKPGYEKLCC
LRCIQTAESKFGSTCICRVPKSKLDKDQRVRCTHCGCNGCASCD

3D structure

• PDB: 3jb9 Structure of a yeast spliceosome at 3.6-angstrom resolution
• Chain: e
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e	A90 K93 K94	A88 K91 K92
BS02	rna	e	G96 E98 S111 K112 S115 T116 C117 I118 R120 V121 P122 K125 Q130 T135 S144 C145	G94 E96 S109 K110 S113 T114 C115 I116 R118 V119 P120 K123 Q128 T133 S142 C143
BS03	ZN	e	C101 C102 C137	C99 C100 C135
BS04	ZN	e	C101 C139 C142	C99 C137 C140
BS05	ZN	e	C117 C119 C134 C139	C115 C117 C132 C137

Gene Ontology

Molecular Function

• GO:0003674 molecular_function

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0000974 Prp19 complex
• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005684 U2-type spliceosomal complex
• GO:0071014 post-mRNA release spliceosomal complex

External links

• PDB: RCSB:3jb9, PDBe:3jb9, PDBj:3jb9
• PDBsum: 3jb9
• PubMed: 26292707
• UniProt: O74772|CWF14_SCHPO Pre-mRNA-splicing factor cwf14 (Gene Name=cwf14)