Structure of PDB 5y6p Chain dz

Receptor sequence

>5y6pdz (length=303) Species: 35689 (Griffithsia pacifica)

DYGITLDTLLYHPTPTISGVEDKDLICYSVWKQVFGNAYVMESERADAYV
PESMFRAGQIPLREFVRGVALSATYRRRFFECCGPYRAVELNFRHLLGRA
PVSQKEVSEHIKLIAAKGFEAEINSYIDSEEYEEAFGDDLVPYMRFKGTY
TTCEEFNRMCTMYSAPGTTDKSLSIRARTQGIENPNHVLSLDGAGVPSKL
VSIIAMGSHSSFVPVKRALPSRPDLEFGQSTKAPAQVNENANPVSRVEVC
MGSYMYLTAEEAAQYNTDVMEQDQIASYAETEISEAETEIARLQAKIAEL
NLI

3D structure

• PDB: 5y6p Structure of phycobilisome from the red alga Griffithsia pacifica
• Chain: dz
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	dz	P133 Y134 S156	P85 Y86 S108
BS02	PEB	dz	T53 Y198	T5 Y150
BS03	PEB	dz	V98 S101	V50 S53
BS04	PEB	dz	K247 S250	K199 S202
BS05	PEB	dz	Y87 G215 T217 S238	Y39 G167 T169 S190

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 24 21:48:58 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5y6p', asym_id = 'dz', title = 'Structure of phycobilisome from the red alga Griffithsia pacifica'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5y6p', asym_id='dz', title='Structure of phycobilisome from the red alga Griffithsia pacifica')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '5y6p', asym_id = 'dz'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='5y6p', asym_id='dz')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>