Structure of PDB 5y6p Chain dx

Receptor sequence

>5y6pdx (length=277) Species: 35689 (Griffithsia pacifica) [Search protein sequence]

VVDPFQRKFQSIGKIGIDYSRPKKLATYKRVGYSVGLDFPNAVSMAGHYS
LTDCTRAGGAAKILMKYDEYCAKGMLQVYKRSAVSTGVYTTKCTEATQPG
VAYDVRVFNRTAAFRQAQKPVNVRLGEQYAARKACVTLAHNCSREEAQFK
NMPMSCATFLAGKMEAMGTCYRTVRPSSKAEDYMAGSVRMQVYQKGNASG
VYPVGGCEDGHAKGDADLRRVIALASEYRAAQQGAAAVTGAQYASSKMAI
QLYGHSCNHEEGQFCDYPAVAAAMCRY

3D structure

PDB

5y6p Structure of phycobilisome from the red alga Griffithsia pacifica

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	dx	K55 I56 Y60 Y69	K14 I15 Y19 Y28
BS02	PEB	dx	Y224 M225	Y183 M184
BS03	PEB	dx	L265 Y269	L224 Y228
BS04	PEB	dx	N163 Y170	N122 Y129
BS05	PEB	dx	R151 R156	R110 R115
BS06	PEB	dx	D44 Q47	D3 Q6
BS07	PEB	dx	F80 P81 A87 G88 Y90 S91 L92 C95 A158 R165	F39 P40 A46 G47 Y49 S50 L51 C54 A117 R124
BS08	PEB	dx	C112 M116 C183 E186 Q189	C71 M75 C142 E145 Q148
BS09	PEB	dx	M225 V229 Q232 C298 E301 Q304	M184 V188 Q191 C257 E260 Q263
BS10	PVN	dx	E136 M205 E206 C211 R213 R260 I263 Y318	E95 M164 E165 C170 R172 R219 I222 Y277
BS11	PUB	dx	Y243 C248 D250 R261 L265	Y202 C207 D209 R220 L224
BS12	PUB	dx	N82 Y130 C134 E136 A143 Y144 R147	N41 Y89 C93 E95 A102 Y103 R106

External links

PDB	RCSB:5y6p, PDBe:5y6p, PDBj:5y6p
PDBsum	5y6p
PubMed	29045394

[Back to BioLiP]