Structure of PDB 8rd8 Chain dh

Receptor sequence

>8rd8dh (length=64) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]

KVKMKTKSGAAKRFKRTANGFKRKQAFKSHILTKKSSKRIRQLRGLKMVD
KSDEAAVRRMCPYI

3D structure

PDB

8rd8 A new family of bacterial ribosome hibernation factors

Chain

Resolution

2.62 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	dh	K2 V3 K4 M5 K6 T7 K8 S9 K13 R14 K16 T18 A19 N20 K23 R24 Q26 A27 F28 S30 H31 I32 L33 T34 K35 S38 K39 R40 I41 R42 Q43 L44 R45 L47 D51 S53 D54 R60 Y64	K1 V2 K3 M4 K5 T6 K7 S8 K12 R13 K15 T17 A18 N19 K22 R23 Q25 A26 F27 S29 H30 I31 L32 T33 K34 S37 K38 R39 I40 R41 Q42 L43 R44 L46 D50 S52 D53 R59 Y63

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links