Structure of PDB 8h2i Chain dg

Receptor sequence
>8h2idg (length=32) Species: 10506 (Paramecium bursaria Chlorella virus 1) [Search protein sequence]
NPLNDPIMIRTMIVYGNLSATYFTGNGAALTQ
3D structure
PDB8h2i Near-atomic, non-icosahedrally averaged structure of giant virus Paramecium bursaria chlorella virus 1.
Chaindg
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide dg I14 M17 I18 V19 Y20 N22 L23 S24 A25 T26 Y27 F28 G30 N31 A33 A34 L35 T36 I9 M12 I13 V14 Y15 N17 L18 S19 A20 T21 Y22 F23 G25 N26 A28 A29 L30 T31
External links