Structure of PDB 7b25 Chain dd

Receptor sequence
>7b25dd (length=91) Species: 405948 (Saccharopolyspora erythraea NRRL 2338) [Search protein sequence]
GDSVEPVDTDLRRVDEVARSGGGRALVCRIAEHVQLDPDLMSELKKVGVV
PGNEIDIVAVAGVNKPIQVQGSEGGTQLQPGIAHAVMVRVK
3D structure
PDB7b25 The bacterial iron sensor IdeR recognizes its DNA targets by indirect readout.
Chaindd
Resolution2.34 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CO dd E172 Q175 E32 Q35
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sun Dec 1 13:35:39 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7b25', asym_id = 'dd', title = 'The bacterial iron sensor IdeR recognizes its DNA targets by indirect readout.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7b25', asym_id='dd', title='The bacterial iron sensor IdeR recognizes its DNA targets by indirect readout.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003677,0003700,0006355,0046914,0046983', uniprot = '', pdbid = '7b25', asym_id = 'dd'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0003700,0006355,0046914,0046983', uniprot='', pdbid='7b25', asym_id='dd')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>