Structure of PDB 8ipb Chain db

Receptor sequence

>8ipbdb (length=95) Species: 4565 (Triticum aestivum) [Search protein sequence]

TFKRRNGGRNKHGRGHVKYIRCSNCAKCCPKDKAIKRFLVRNIVEQAAVR
DVQEACVHDGYVLPKLYAKVHHCVSCAIHAHIVRVRSRENRRNRE

3D structure

PDB

8ipb Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	db	T2 F3 K4 R5 R6 G9 R10 K12 H13 G14 R15 G16 H17 Y20 K32 K34 K37 R38 K70 V75 S76 I79 H80 V84 R85 V86 R87 S88 R89 R92 R95 E96	T1 F2 K3 R4 R5 G8 R9 K11 H12 G13 R14 G15 H16 Y19 K31 K33 K36 R37 K69 V74 S75 I78 H79 V83 R84 V85 R86 S87 R88 R91 R94 E95
BS02	ZN	db	C23 C26 C77	C22 C25 C76

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links