Structure of PDB 8ip9 Chain db

Receptor sequence
>8ip9db (length=95) Species: 4565 (Triticum aestivum) [Search protein sequence]
TFKRRNGGRNKHGRGHVKYIRCSNCAKCCPKDKAIKRFLVRNIVEQAAVR
DVQEACVHDGYVLPKLYAKVHHCVSCAIHAHIVRVRSRENRRNRE
3D structure
PDB8ip9 Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.
Chaindb
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna db T2 F3 K4 R5 R6 N7 G9 R10 N11 H13 G14 R15 G16 H17 Y20 K32 K34 R38 K70 V75 I79 H80 R85 V86 R87 S88 R89 R92 R93 R95 T1 F2 K3 R4 R5 N6 G8 R9 N10 H12 G13 R14 G15 H16 Y19 K31 K33 R37 K69 V74 I78 H79 R84 V85 R86 S87 R88 R91 R92 R94
BS02 ZN db C23 C26 C77 C22 C25 C76
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ip9, PDBe:8ip9, PDBj:8ip9
PDBsum8ip9
PubMed38267667
UniProtA0A3B6LWE1

[Back to BioLiP]