Structure of PDB 6kgx Chain dJ

Receptor sequence
>6kgxdJ (length=285) Species: 35688 (Porphyridium purpureum) [Search protein sequence]
ITLSGVAASQPVSAPAKMSLEDRQLLVLQAIKQVFGNAYVMEEERASFAK
QESMFLSGELSVREFVRELALSDTYRRRFFEPCGPYRFVELNMKHLLGRG
PISQAEVSQHVQCYVNNGYEAEISSYVDSDEYYERFGEDTVPYEQFRGTY
MTAEDFNRMVSMYGAPGQSDKSLTSRARSTGVANSNKVLSLEGAGRSSKT
VGRVATNTASSLTSVKSGIPPRPDIDQPRGQSSKRLVGRRLEIVPGSYMY
LSPAEAAEYRAQQAAVSQVSAAFSADVQSKMAQVS
3D structure
PDB6kgx Structural basis of energy transfer in Porphyridium purpureum phycobilisome.
ChaindJ
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PEB dJ L280 V281 G282 L236 V237 G238
BS02 PEB dJ P129 Q148 P85 Q104
BS03 PEB dJ Y83 G211 S213 K215 L217 Y39 G167 S169 K171 L173
BS04 PEB dJ G49 V50 G192 T193 Y194 A197 F200 R266 G5 V6 G148 T149 Y150 A153 F156 R222
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Dec 3 09:41:31 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6kgx', asym_id = 'dJ', title = 'Structural basis of energy transfer in Porphyridium purpureum phycobilisome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6kgx', asym_id='dJ', title='Structural basis of energy transfer in Porphyridium purpureum phycobilisome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '6kgx', asym_id = 'dJ'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='6kgx', asym_id='dJ')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>