Structure of PDB 7y5e Chain dD

Receptor sequence

>7y5edD (length=285) Species: 35688 (Porphyridium purpureum)

ITLSGVAASQPVSAPAKMSLEDRQLLVLQAIKQVFGNAYVMEEERASFAK
QESMFLSGELSVREFVRELALSDTYRRRFFEPCGPYRFVELNMKHLLGRG
PISQAEVSQHVQCYVNNGYEAEISSYVDSDEYYERFGEDTVPYEQFRGTY
MTAEDFNRMVSMYGAPGQSDKSLTSRARSTGVANSNKVLSLEGAGRSSKT
VGRVATNTASSLTSVKSGIPPRPDIDQPRGQSSKRLVGRRLEIVPGSYMY
LSPAEAAEYRAQQAAVSQVSAAFSADVQSKMAQVS

3D structure

• PDB: 7y5e In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.
• Chain: dD
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	dD	S101 L104	S53 L56
BS02	PEB	dD	P133 Q152	P85 Q104
BS03	PEB	dD	A86 Y87 G215 S217 K219	A38 Y39 G167 S169 K171
BS04	PEB	dD	G53 V54 G196 T197 Y198 A201 F204 R270	G5 V6 G148 T149 Y150 A153 F156 R222
BS05	PEB	dD	R244 K247 T248 V249 G250 R251	R196 K199 T200 V201 G202 R203
BS06	PEB	dD	L284 V285 G286 R287	L236 V237 G238 R239

Gene Ontology

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0030089 phycobilisome

External links

• PDB: RCSB:7y5e, PDBe:7y5e, PDBj:7y5e
• PDBsum: 7y5e
• PubMed: 36922595
• UniProt: A0A5J4Z162