Structure of PDB 7dr2 Chain dC

Receptor sequence

>7dr2dC (length=80) Species: 2762 (Cyanophora paradoxa)

AHTVKIYDTCIGCTQCVRACPTDVLEMVPWDGCRANQIASAPRTEDCVGC
KRCESACPTDFLSIRVYLGAETTRSMGLGY

3D structure

• PDB: 7dr2 Structural insights into an evolutionary turning-point of photosystem I from prokaryotes to eukaryotes
• Chain: dC
• Resolution: 3.8 Å

Enzymatic activity

• Enzyme Commision number: 1.97.1.12: photosystem I.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	dC	C21 P22 V25 L26 C48 V49 G50 C51 K52 R53 C54 V67	C20 P21 V24 L25 C47 V48 G49 C50 K51 R52 C53 V66
BS02	SF4	dC	C11 I12 G13 C14 C17 C58 P59 S64 I65	C10 I11 G12 C13 C16 C57 P58 S63 I64

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009773 photosynthetic electron transport in photosystem I
• GO:0015979 photosynthesis

Cellular Component

• GO:0009522 photosystem I
• GO:0009579 thylakoid
• GO:0009842 cyanelle
• GO:0016020 membrane
• GO:0033115 cyanelle thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:7dr2, PDBe:7dr2, PDBj:7dr2
• PDBsum: 7dr2
• UniProt: P31173|PSAC_CYAPA Photosystem I iron-sulfur center (Gene Name=psaC)