Structure of PDB 5tgm Chain d9

Receptor sequence
>5tgmd9 (length=53) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
ENVWFSHPRRYGKGSRQCRVCSSHTGLIRKYGLNICRQCFREKANDIGFN
KFR
3D structure
PDB5tgm Molecular insights into protein synthesis with proline residues.
Chaind9
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna d9 W7 F8 S9 H10 P11 R12 R13 Y14 G15 K16 R19 C24 I31 R32 Y34 R40 Q41 R44 E45 K54 F55 R56 W4 F5 S6 H7 P8 R9 R10 Y11 G12 K13 R16 C21 I28 R29 Y31 R37 Q38 R41 E42 K51 F52 R53
BS02 ZN d9 C21 C24 C42 C18 C21 C39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5tgm, PDBe:5tgm, PDBj:5tgm
PDBsum5tgm
PubMed27827794
UniProtP41057|RS29A_YEAST Small ribosomal subunit protein uS14A (Gene Name=RPS29A)

[Back to BioLiP]