Structure of PDB 5dgf Chain d8

Receptor sequence
>5dgfd8 (length=63) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
TPVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTSRTIVRNVKGPVRENDIL
VLMESEREARRLR
3D structure
PDB5dgf Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
Chaind8
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna d8 R18 S21 R22 G23 R14 S17 R18 G19
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000054 ribosomal subunit export from nucleus
GO:0006412 translation
GO:0030490 maturation of SSU-rRNA
GO:1900153 positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5dgf, PDBe:5dgf, PDBj:5dgf
PDBsum5dgf
PubMed
UniProtQ3E7X9|RS28A_YEAST Small ribosomal subunit protein eS28A (Gene Name=RPS28A)

[Back to BioLiP]