Structure of PDB 4u3u Chain d3

Receptor sequence

>4u3ud3 (length=144) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

GKGKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKG
IVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDE
VLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS

3D structure

PDB

4u3u ?

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	d3	G2 K3 G4 K5 P6 R7 G8 N10 R13 K14 R19 R20 N22 R23 W24 A25 E26 K30 R32 L33 F38 S46 S47 H48 K50 K62 Q63 N65 S66 A67 I68 R69 K70 P88 N89 D90 G91 G106 F107 G108 R109 K110 K112 K114 G115 D116 K123 K126 K139 K140	G1 K2 G3 K4 P5 R6 G7 N9 R12 K13 R18 R19 N21 R22 W23 A24 E25 K29 R31 L32 F37 S45 S46 H47 K49 K61 Q62 N64 S65 A66 I67 R68 K69 P87 N88 D89 G90 G105 F106 G107 R108 K109 K111 K113 G114 D115 K122 K125 K138 K139

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation
GO:0006450	regulation of translational fidelity
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4u3u, PDBe:4u3u, PDBj:4u3u
PDBsum	4u3u
PubMed	25209664
UniProt	P0CX29\|RS23A_YEAST Small ribosomal subunit protein uS12A (Gene Name=RPS23A)