Structure of PDB 7oyb Chain d2

Receptor sequence

>7oybd2 (length=55) Species: 7955 (Danio rerio) [Search protein sequence]

GHQQLYWSHPRKYGQGSRSCRVCSNRHGLIRKYGLNMCRQCFRQYAKDIG
FVKLD

3D structure

PDB

7oyb A molecular network of conserved factors keeps ribosomes dormant in the egg.

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	d2	H3 L6 Y7 W8 H10 K13 Y14 G15 Q16 G17 R19 C24 N26 R27 G29 L30 I31 R32 K33 Y34 R40 Q41 C42 R44 Q45 K54 L55 D56	H2 L5 Y6 W7 H9 K12 Y13 G14 Q15 G16 R18 C23 N25 R26 G28 L29 I30 R31 K32 Y33 R39 Q40 C41 R43 Q44 K53 L54 D55
BS02	ZN	d2	C24 C42	C23 C41

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding

	Biological Process
GO:0001525	angiogenesis
GO:0001570	vasculogenesis
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0030218	erythrocyte differentiation
GO:0043009	chordate embryonic development
GO:0048821	erythrocyte development
GO:0051726	regulation of cell cycle
GO:0060218	hematopoietic stem cell differentiation
GO:0072332	intrinsic apoptotic signaling pathway by p53 class mediator

	Cellular Component
GO:0005791	rough endoplasmic reticulum
GO:0005840	ribosome
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links