Structure of PDB 7oya Chain d2

Receptor sequence

>7oyad2 (length=49) Species: 7955 (Danio rerio) [Search protein sequence]

YWSHPRKYGQGSRSCRVCSNRHGLIRKYGLNMCRQCFRQYAKDIGFVKL

3D structure

PDB

7oya A molecular network of conserved factors keeps ribosomes dormant in the egg.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	d2	W8 R12 Y14 Q16 R19 C24 N26 R27 H28 G29 I31 R32 K33 Y34 R40 Q41 R44 K54	W2 R6 Y8 Q10 R13 C18 N20 R21 H22 G23 I25 R26 K27 Y28 R34 Q35 R38 K48
BS02	ZN	d2	V23 C24	V17 C18

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding

	Biological Process
GO:0001525	angiogenesis
GO:0001570	vasculogenesis
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0030218	erythrocyte differentiation
GO:0043009	chordate embryonic development
GO:0048821	erythrocyte development
GO:0051726	regulation of cell cycle
GO:0060218	hematopoietic stem cell differentiation
GO:0072332	intrinsic apoptotic signaling pathway by p53 class mediator

	Cellular Component
GO:0005791	rough endoplasmic reticulum
GO:0005840	ribosome
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links