Structure of PDB 4u4u Chain d2

Receptor sequence

>4u4ud2 (length=129) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFE
YIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGY
VILTTSAGIMDHEEARRKHVSGKILGFVY

3D structure

PDB

4u4u ?

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	d2	T2 R3 S4 A8 D9 N12 N16 K19 T20 R28 K32 H56 R57 S58 K71 V74 I75 S76 R78 N80 K82 K88 W89 T105 T106 S107 R118 K119 H120 S122 K124 Y130	T1 R2 S3 A7 D8 N11 N15 K18 T19 R27 K31 H55 R56 S57 K70 V73 I74 S75 R77 N79 K81 K87 W88 T104 T105 S106 R117 K118 H119 S121 K123 Y129

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4u4u, PDBe:4u4u, PDBj:4u4u
PDBsum	4u4u
PubMed	25209664
UniProt	P0C0W1\|RS22A_YEAST Small ribosomal subunit protein uS8A (Gene Name=RPS22A)