Structure of PDB 7piw Chain d1

Receptor sequence

>7piwd1 (length=348) Species: 3046 (Dunaliella salina) [Search protein sequence]

IGTYQEKRTWFDDADDWLRQDRFVFVGWSGLLLLPCAYFAVGGWLTGCTF
VTSWYTHGLASSYIEGCNFLTAAVSTPANSLGHSLLFVWGPEAQGDLTRW
FQLGGLWAFVALHGAFGLIGFMLRQFEIARSVNLRPYNAIAFSAPIAVFV
SVFLIYPLGQSGWFFAPSFGVASIFRFILFFQGFHNWTLNPFHMMGVAGV
LGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWS
QIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIR
AAEDPEFETFYTKNILLNEGIRAWMAAQDQPHEKLTLPEEVLPRGNAL

3D structure

PDB

7piw Structure of Dunaliella Photosystem II reveals conformational flexibility of stacked and unstacked supercomplexes.

Chain

Resolution

4.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	d1	S84 H336 E337	S80 H332 E333
BS02	FE2	d1	H214 Y244 K264 H268	H210 Y240 K260 H264
BS03	CLA	d1	M198 V201 A202	M194 V197 A198
BS04	CLA	d1	F153 V175 I178	F149 V171 I174
BS05	PHO	d1	L205 A208 L209 I213 W253 F257	L201 A204 L205 I209 W249 F253
BS06	PHO	d1	W48 G118 G121 L122 F125 Q129 A145 F146 P149 F153 F173 G174 L279	W44 G114 G117 L118 F121 Q125 A141 F142 P145 F149 F169 G170 L275
BS07	CLA	d1	F120 I123 M126 L127 F130	F116 I119 M122 L123 F126
BS08	CLA	d1	L122 F146 P149 V152 V156 I182 W191 H197 V201 V204 A283	L118 F142 P145 V148 V152 I178 W187 H193 V197 V200 A279
BS09	CLA	d1	F43 W93 W104 F113 L116 H117	F39 W89 W100 F109 L112 H113

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009507	chloroplast
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7piw, PDBe:7piw, PDBj:7piw
PDBsum	7piw
PubMed	36799903
UniProt	D0FXW8

[Back to BioLiP]