Structure of PDB 6gzx Chain d1

Receptor sequence
>6gzxd1 (length=61) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLA
KPEAERIKLLL
3D structure
PDB6gzx Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
Chaind1
Resolution4.57 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna d1 K3 K5 T6 H7 K8 K11 K12 K15 S19 K26 T27 G28 K29 R30 H31 N33 W34 K36 S37 K39 R42 R46 F48 L50 E54 A55 L62 K2 K4 T5 H6 K7 K10 K11 K14 S18 K25 T26 G27 K28 R29 H30 N32 W33 K35 S36 K38 R41 R45 F47 L49 E53 A54 L61
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gzx, PDBe:6gzx, PDBj:6gzx
PDBsum6gzx
PubMed30301898
UniProtQ5SKU1|RL35_THET8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]