Structure of PDB 8uu6 Chain d

Receptor sequence

>8uu6d (length=199) Species: 1642 (Listeria innocua)

ARYTGPSWKVSRRLGISLSGTGKELERRPYAPGQHGPTQRKKISEYGLQQ
AEKQKLRHMYGLTERQFKNTFNKAGKLQGKHGENFMILLEQRLDNIVYRL
GLARTRRAARQLVNHGHITVDGKRVDIPSYQVSVGQVISVREKSAKNSAI
AESLEVSSFVPEYVTFDAETLTGSLNRLPERSELAAEINEAFIVEFYSR

3D structure

• PDB: 8uu6 Mechanistic insights into the alternative ribosome recycling by HflXr.
• Chain: d
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	d	A2 R3 P7 S8 W9 K10 G34 Q35 Y47 Q55 T64 E65 R66 R108 R111 N115 H116 V126 I128 Y131 N148 R200	A1 R2 P6 S7 W8 K9 G33 Q34 Y46 Q54 T63 E64 R65 R107 R110 N114 H115 V125 I127 Y130 N147 R199

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Dec 2 10:44:54 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8uu6', asym_id = 'd', title = 'Mechanistic insights into the alternative ribosome recycling by HflXr.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8uu6', asym_id='d', title='Mechanistic insights into the alternative ribosome recycling by HflXr.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0006412,0015935,0019843', uniprot = '', pdbid = '8uu6', asym_id = 'd'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0006412,0015935,0019843', uniprot='', pdbid='8uu6', asym_id='d')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>