Structure of PDB 8r57 Chain d

Receptor sequence
>8r57d (length=55) Species: 4565 (Triticum aestivum) [Search protein sequence]
GHSNVWNSHPKNYGAGSRVCRVCGNSHGLIRKYGLMCCRQCFRSDAKDIG
FIKYR
3D structure
PDB8r57 High-Resolution Structure and Internal Mobility of a Plant 40S Ribosomal Subunit.
Chaind
Resolution2.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna d G2 H3 N5 V6 W7 N8 S9 H10 Y14 G15 A16 G17 R19 C24 N26 H28 G29 L30 I31 R32 K33 Y34 R40 Q41 R44 K54 Y55 R56 G1 H2 N4 V5 W6 N7 S8 H9 Y13 G14 A15 G16 R18 C23 N25 H27 G28 L29 I30 R31 K32 Y33 R39 Q40 R43 K53 Y54 R55
BS02 ZN d C21 C24 C39 C42 C20 C23 C38 C41
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8r57, PDBe:8r57, PDBj:8r57
PDBsum8r57
PubMed38139282
UniProtQ5I7K3|RS29_WHEAT Small ribosomal subunit protein uS14 (Gene Name=RPS29)

[Back to BioLiP]