Structure of PDB 8ow0 Chain d

Receptor sequence
>8ow0d (length=95) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SKARKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASK
LAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSS
3D structure
PDB8ow0 Cryo-EM structure of the complete inner kinetochore of the budding yeast point centromere.
Chaind
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna d S34 K90 S91 T92 S1 K57 S58 T59
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006301 postreplication repair
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ow0, PDBe:8ow0, PDBj:8ow0
PDBsum8ow0
PubMed37506202
UniProtP02293|H2B1_YEAST Histone H2B.1 (Gene Name=HTB1)

[Back to BioLiP]