Structure of PDB 8ir8 Chain d

Receptor sequence

>8ir8d (length=341) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]

RGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTH
GLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLW
TFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYP
LGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLC
AIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAF
SNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEF
ETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL

3D structure

PDB

8ir8 Oxygen-evolving photosystem II structures during S1-S2-S3 transitions.

Chain

Resolution

2.25 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FE2	d	H214 H268	H203 H257
BS02	CLA	d	F157 I178 F179 L182	F146 I167 F168 L171
BS03	PHO	d	L209 I213 W253 F257	L198 I202 W242 F246
BS04	PHO	d	A41 W48 G121 F125 Q129 N142 F146 P149 V175 P275 L279	A30 W37 G110 F114 Q118 N131 F135 P138 V164 P264 L268
BS05	CLA	d	F120 I123 M126 L127	F109 I112 M115 L116
BS06	BCT	d	H214 Y244 H268	H203 Y233 H257
BS07	CLA	d	M198 V201 A202	M187 V190 A191
BS08	CLA	d	V152 V156 F181 L182 F185 Q186 W191 T192 H197 G200 V204 L205 S282 A283	V141 V145 F170 L171 F174 Q175 W180 T181 H186 G189 V193 L194 S271 A272
BS09	CLA	d	P39 C40 L43 L91 L92 W93 T112 F113 H117	P28 C29 L32 L80 L81 W82 T101 F102 H106

Gene Ontology

	Molecular Function
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009523	photosystem II
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ir8, PDBe:8ir8, PDBj:8ir8
PDBsum	8ir8
PubMed	38297122
UniProt	D0VWR8\|PSBD_THEVL Photosystem II D2 protein (Fragment) (Gene Name=psbD)

[Back to BioLiP]