Structure of PDB 8gn1 Chain d

Receptor sequence

>8gn1d (length=342) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]

ERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYT
HGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGL
WTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIY
PLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALL
CAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIA
FSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPE
FETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL

3D structure

PDB

8gn1 Structural insights into the action mechanisms of artificial electron acceptors in photosystem II.

Chain

Resolution

2.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FE2	d	H214 H268	H204 H258
BS02	BCT	d	H214 Y244 H268	H204 Y234 H258
BS03	CLA	d	I178 L182	I168 L172
BS04	PHO	d	L205 L209 I213 W253 F257	L195 L199 I203 W243 F247
BS05	PHO	d	A41 W48 G121 L122 F125 Q129 N142 F146 P149 F153 G174 V175 P275 L279	A31 W38 G111 L112 F115 Q119 N132 F136 P139 F143 G164 V165 P265 L269
BS06	CLA	d	F120 I123 M126 L127 F130	F110 I113 M116 L117 F120
BS07	CLA	d	M198 V201 A202 L205	M188 V191 A192 L195
BS08	CLA	d	P149 V152 V156 F181 L182 F185 Q186 W191 T192 H197 G200 S282 A283	P139 V142 V146 F171 L172 F175 Q176 W181 T182 H187 G190 S272 A273
BS09	CLA	d	P39 C40 L43 L91 L92 W93 T112 F113 H117	P29 C30 L33 L81 L82 W83 T102 F103 H107

Gene Ontology

	Molecular Function
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009523	photosystem II
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8gn1, PDBe:8gn1, PDBj:8gn1
PDBsum	8gn1
PubMed	37209822
UniProt	D0VWR8\|PSBD_THEVL Photosystem II D2 protein (Fragment) (Gene Name=psbD)

[Back to BioLiP]