Structure of PDB 8e6w Chain d

Receptor sequence

>8e6wd (length=417) Species: 562 (Escherichia coli)

MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIF
GDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGK
IRPPKEGERYFALLKVNEVNFDKPENARNKILFENLTPLHANSRLRMERG
NGSTEDLTARVLDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHP
DCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHVQVAEMVIEKA
KRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF
FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIA
EKRVFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLI
NKLAMTKTNDDFFEMMK

3D structure

• PDB: 8e6w Structural basis of Rho-dependent transcription termination.
• Chain: d
• Resolution: 4.27 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	d	Y80 S82 Q85 R87 R88 F89 E108 R109 Y110 L114 V116	Y80 S82 Q85 R87 R88 F89 E108 R109 Y110 L114 V116
BS02	ADP	d	R366 K367	R366 K367
BS03	ADP	d	A182 G183 K184 T185 M186 F355	A182 G183 K184 T185 M186 F355
BS04	BEF	d	P180 K184	P180 K184

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0004386 helicase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0008186 ATP-dependent activity, acting on RNA
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006353 DNA-templated transcription termination

Cellular Component

• GO:0005829 cytosol
• GO:0016020 membrane

External links

• PDB: RCSB:8e6w, PDBe:8e6w, PDBj:8e6w
• PDBsum: 8e6w
• PubMed: 36697824
• UniProt: P0AG30|RHO_ECOLI Transcription termination factor Rho (Gene Name=rho)