Structure of PDB 8ccs Chain d

Receptor sequence

>8ccsd (length=206) Species: 4932 (Saccharomyces cerevisiae)

SLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDGVHVINVG
KTWEKLVLAARIIAAIPNPEDVVAISSRTFGQRAVLKFAAHTGATPIAGR
FTPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDS
PSEFVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALVDRTQPWSIMPDL
YFYRDP

3D structure

• PDB: 8ccs Cryo-EM analysis of eukaryotic ribosome translocation intermediates
• Chain: d
• Resolution: 1.97 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	d	N28 R101 P104 G105 T108 N109 Y110 R113 Q131 E135 Y138	N27 R100 P103 G104 T107 N108 Y109 R112 Q130 E134 Y137

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0000054 ribosomal subunit export from nucleus
• GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000461 endonucleolytic cleavage to generate mature 3'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006364 rRNA processing
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0010494 cytoplasmic stress granule
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ccs, PDBe:8ccs, PDBj:8ccs
• PDBsum: 8ccs
• PubMed: 38030725
• UniProt: P32905|RSSA1_YEAST Small ribosomal subunit protein uS2A (Gene Name=RPS0A)