Structure of PDB 8byq Chain d

Receptor sequence
>8byqd (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence]
RRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEAS
RLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
3D structure
PDB8byq Structural basis of transcription reduction by a promoter-proximal +1 nucleosome.
Chaind
Resolution4.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna d S33 Y43 G54 I55 S56 S57 R87 S88 T89 S4 Y14 G25 I26 S27 S28 R58 S59 T60
BS02 dna d R30 R31 R34 S37 I40 Y41 R1 R2 R5 S8 I11 Y12
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8byq, PDBe:8byq, PDBj:8byq
PDBsum8byq
PubMed37148879
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]