Structure of PDB 8bd3 Chain d

Receptor sequence

>8bd3d (length=342) Species: 2649997 (Chlorella ohadii) [Search protein sequence]

KRGWFDVVDDWLRRDRFVFVGWSGLLLFPTAYLALGGWFTGTTFVTSWYT
HGLASSYLEGCNFLTAAVSTPANSMGHSLLFLWGPEAQGDFTRWCQLGGL
WTFVALHGSFSLIGFMLRQFEIARSVKIRPYNAIAFSAPISVFVSVFLIY
PLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALL
CAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWSQIFGVA
FSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFVSQEIRAAEDPE
FETFYTKNILLNEGIRAWMAAQDQPHEKLVFPEEVLPRGNAL

3D structure

PDB

8bd3 Structure of Chlorella ohadii Photosystem II Reveals Protective Mechanisms against Environmental Stress.

Chain

Resolution

2.73 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FE2	d	H214 H268	H204 H258
BS02	CLA	d	M198 V201	M188 V191
BS03	PHO	d	L205 L209 I213 W253 F257	L195 L199 I203 W243 F247
BS04	CLA	d	F120 I123 M126 L127 F130	F110 I113 M116 L117 F120
BS05	CLA	d	I178 F179	I168 F169
BS06	PHO	d	L45 W48 S121 L122 F125 Q129 N142 F146 P149 F153 L279	L35 W38 S111 L112 F115 Q119 N132 F136 P139 F143 L269
BS07	BCT	d	Y244 K264 H268	Y234 K254 H258
BS08	CLA	d	P149 V152 V156 F181 I182 F185 Q186 W191 T192 H197 G200 V201 L205 L279 S282 A283 V286	P139 V142 V146 F171 I172 F175 Q176 W181 T182 H187 G190 V191 L195 L269 S272 A273 V276
BS09	CLA	d	L36 P39 T40 L43 L90 F91 L92 W93 T112 F113 L116 H117 F120	L26 P29 T30 L33 L80 F81 L82 W83 T102 F103 L106 H107 F110

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009507	chloroplast
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8bd3, PDBe:8bd3, PDBj:8bd3
PDBsum	8bd3
PubMed	37566050
UniProt	W8SYD4

[Back to BioLiP]