Structure of PDB 7z34 Chain d

Receptor sequence
>7z34d (length=107) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
DVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVRLAPEL
NQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVASAKGLQ
TVVVEED
3D structure
PDB7z34 Visualizing maturation factor extraction from the nascent ribosome by the AAA-ATPase Drg1.
Chaind
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna d R10 T13 H17 K18 H21 G22 V23 S24 F25 K26 R31 H43 L51 N56 Q57 W60 R62 K65 Y69 R70 K102 Q105 R5 T8 H12 K13 H16 G17 V18 S19 F20 K21 R26 H38 L46 N51 Q52 W55 R57 K60 Y64 R65 K97 Q100
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006450 regulation of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7z34, PDBe:7z34, PDBj:7z34
PDBsum7z34
PubMed36097293
UniProtP0C2H8|RL31A_YEAST Large ribosomal subunit protein eL31A (Gene Name=RPL31A)

[Back to BioLiP]