Structure of PDB 7ut1 Chain d

Receptor sequence

>7ut1d (length=49) Species: 11757 (Mouse mammary tumor virus)

PMVMWKDLLTGSWKGPDVLITAGRGYACVFPQDAESPIWVPDRFIRPFT

3D structure

• PDB: 7ut1 B-to-A transition in target DNA during retroviral integration.
• Chain: d
• Resolution: 3.8 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.-
  2.7.7.49: RNA-directed DNA polymerase.
  2.7.7.7: DNA-directed DNA polymerase.
  3.1.-.-
  3.1.26.4: ribonuclease H.
  3.4.23.-
  3.6.1.23: dUTP diphosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	d	R240 G241 W255 R259	R24 G25 W39 R43

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0008270 zinc ion binding

Biological Process

• GO:0015074 DNA integration

External links

• PDB: RCSB:7ut1, PDBe:7ut1, PDBj:7ut1
• PDBsum: 7ut1
• PubMed: 35947647
• UniProt: P03365|POL_MMTVB Gag-Pro-Pol polyprotein (Gene Name=gag-pro-pol)