Structure of PDB 7s0s Chain d

Receptor sequence
>7s0sd (length=49) Species: 1772 (Mycolicibacterium smegmatis) [Search protein sequence]
DVRPKITLACEVCKHRNYITKKNRRNDPDRLEIKKFCPNCGTHQPHKES
3D structure
PDB7s0s 50S subunit recognition and modification by the Mycobacterium tuberculosis ribosomal RNA methyltransferase TlyA.
Chaind
Resolution3.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna d R8 K10 H20 Y23 I24 T25 N28 N31 K40 F41 G46 T47 H48 R3 K5 H15 Y18 I19 T20 N23 N26 K35 F36 G41 T42 H43
BS02 ZN d C15 C18 C42 C45 C10 C13 C37 C40
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7s0s, PDBe:7s0s, PDBj:7s0s
PDBsum7s0s
PubMed35357969
UniProtA0QS39|RL331_MYCS2 Large ribosomal subunit protein bL33A (Gene Name=rpmG1)

[Back to BioLiP]