Structure of PDB 7r4d Chain d |
>7r4dd (length=112) Species: 9913 (Bos taurus) [Search protein sequence] |
ATFQFLPDEARSLPPPKLTDPRLAFVGFLGYCSGLIDNAIRRRPVLLAGL HRQLLYITSFVFVGYYLLKRQDYMYAVRDHDMFSYIKSHPEDFPEKDKKT YGEVFEEFHPVR |
|
PDB | 7r4d Structural basis of mammalian respiratory complex I inhibition by medicinal biguanides. |
Chain | d |
Resolution | 2.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
I49 |
d |
M82 Y83 R86 |
M74 Y75 R78 |
|
|
|
|