Structure of PDB 7qiz Chain d

Receptor sequence
>7qizd (length=46) Species: 4081 (Solanum lycopersicum) [Search protein sequence]
NHTAHNQSYKAHRNGIKKPKSHRHSSTKGMDPKFLRNQRYARKHNK
3D structure
PDB7qiz Specific features and methylation sites of a plant ribosome
Chaind
Resolution2.38 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna d N6 H7 T8 A9 H10 N11 Q12 S13 K15 H17 R18 N19 K25 H27 R28 H29 S31 T32 D36 P37 K38 F39 R41 N42 Q43 R44 Y45 A46 R47 K48 H49 N50 N1 H2 T3 A4 H5 N6 Q7 S8 K10 H12 R13 N14 K20 H22 R23 H24 S26 T27 D31 P32 K33 F34 R36 N37 Q38 R39 Y40 A41 R42 K43 H44 N45
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qiz, PDBe:7qiz, PDBj:7qiz
PDBsum7qiz
PubMed35643637
UniProtA0A3Q7GK12

[Back to BioLiP]