Structure of PDB 7pxa Chain d

Receptor sequence
>7pxad (length=215) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
SPEQAMRERSELARKGIARAKSVVALAYAGGVLFVAENPSRSLQKISELY
DRVGFAAAGKFNEFDNLRRGGIQFADTRGYAYDRRDVTGRQLANVYAQTL
GTIFTEQAKPYEVELCVAEVAHYGETKRPELYRITYDGSIADEPHFVVMG
GTTEPIANALKESYAENASLTDALRIAVAALRALGVASLEVAVLDANRPR
RAFRRITGSALQALL
3D structure
PDB7pxa Structural basis of prokaryotic ubiquitin-like protein engagement and translocation by the mycobacterial Mpa-proteasome complex.
Chaind
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide d G23 R26 A27 K28 L50 K52 A65 G66 K67 F68 E119 G16 R19 A20 K21 L43 K45 A58 G59 K60 F61 E112
BS02 peptide d M13 D144 S146 I147 M6 D137 S139 I140
Gene Ontology
Molecular Function
GO:0004175 endopeptidase activity
GO:0004298 threonine-type endopeptidase activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
Biological Process
GO:0010498 proteasomal protein catabolic process
GO:0019941 modification-dependent protein catabolic process
GO:0030682 symbiont-mediated perturbation of host defenses
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0051603 proteolysis involved in protein catabolic process
Cellular Component
GO:0000502 proteasome complex
GO:0005737 cytoplasm
GO:0005839 proteasome core complex
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall
GO:0019773 proteasome core complex, alpha-subunit complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pxa, PDBe:7pxa, PDBj:7pxa
PDBsum7pxa
PubMed35022401
UniProtP9WHU1|PSA_MYCTU Proteasome subunit alpha (Gene Name=prcA)

[Back to BioLiP]