Structure of PDB 7pjt Chain d

Receptor sequence

>7pjtd (length=205) Species: 562 (Escherichia coli) [Search protein sequence]

ARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQAPGQHGARKPRLSDY
GVQLREKQKVRRIYGVLERQFRNYYKEAARLKGNTGENLLALLEGRLDNV
VYRMGFGATRAEARQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAKK
QSRVKAALELAEQREKPTWLEVDAGKMEGTFKRKPERSDLSADINEHLIV
ELYSK

3D structure

PDB

7pjt Structural mechanism of GTPase-powered ribosome-tRNA movement.

Chain

Resolution

6.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	d	A1 R2 P6 K7 L8 K9 R12 R13 K21 S22 R25 K30 C31 K32 Q35 P37 G38 H40 Y50 L54 R55 K57 Q58 L67 E68 R69 Q70 R72 N73 K82 T109 A111 E112 Q115 S118 H119 K120 V129 N130 I131 S133 K147 Q151 R153 E201 S204 K205	A1 R2 P6 K7 L8 K9 R12 R13 K21 S22 R25 K30 C31 K32 Q35 P37 G38 H40 Y50 L54 R55 K57 Q58 L67 E68 R69 Q70 R72 N73 K82 T109 A111 E112 Q115 S118 H119 K120 V129 N130 I131 S133 K147 Q151 R153 E201 S204 K205

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7pjt, PDBe:7pjt, PDBj:7pjt
PDBsum	7pjt
PubMed	34635670
UniProt	C3SR62

[Back to BioLiP]