Structure of PDB 7pir Chain d

Receptor sequence

>7pird (length=175) Species: 272634 (Mycoplasmoides pneumoniae M129)

NLKAHYQKTIAKELQKSFAFSSIMQVPRLEKIVINMGVGDAIRDSKFLES
ALNELHLISGQKPVATKAKNAISTYKLRAGQLIGCKVTLRGERMWAFLEK
LIYVALPRVRDFRGLSLKSFDGRGNYTIGIKEQIIFPEIVYDDIKRIRGF
DVTLVTSTNKDSEALALLRALNLPL

3D structure

• PDB: 7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: d
• Resolution: 12.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	d	N37 M38 G39 V40 G41 T68 A70 K71 N72 I74 T76 Y77 L79 I85 K88 K120 S121 D123 R125 N127 T129 I130 G131 I132 K133 R148 G151 F152 D153	N35 M36 G37 V38 G39 T66 A68 K69 N70 I72 T74 Y75 L77 I83 K86 K118 S119 D121 R123 N125 T127 I128 G129 I130 K131 R146 G149 F150 D151
BS02	rna	d	S23 S24 I25 M26 Q27 R30 Q63 V66 T90 R92 E94 R95	S21 S22 I23 M24 Q25 R28 Q61 V64 T88 R90 E92 R93

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pir, PDBe:7pir, PDBj:7pir
• PDBsum: 7pir
• PubMed: 36171285
• UniProt: Q50306|RL5_MYCPN Large ribosomal subunit protein uL5 (Gene Name=rplE)