Structure of PDB 7pi5 Chain d

Receptor sequence

>7pi5d (length=348) Species: 3046 (Dunaliella salina) [Search protein sequence]

IGTYQEKRTWFDDADDWLRQDRFVFVGWSGLLLLPCAYFAVGGWLTGCTF
VTSWYTHGLASSYIEGCNFLTAAVSTPANSLGHSLLFVWGPEAQGDLTRW
FQLGGLWAFVALHGAFGLIGFMLRQFEIARSVNLRPYNAIAFSAPIAVFV
SVFLIYPLGQSGWFFAPSFGVASIFRFILFFQGFHNWTLNPFHMMGVAGV
LGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWS
QIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIR
AAEDPEFETFYTKNILLNEGIRAWMAAQDQPHEKLTLPEEVLPRGNAL

3D structure

PDB

7pi5 Structure of Dunaliella Photosystem II reveals conformational flexibility of stacked and unstacked supercomplexes.

Chain

Resolution

2.78 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	d	H336 E337 K338	H332 E333 K334
BS02	FE2	d	H214 Y244 H268	H210 Y240 H264
BS03	CLA	d	M198 V201 A202	M194 V197 A198
BS04	CLA	d	F157 I178	F153 I174
BS05	PHO	d	L205 L209 I213 W253 F257	L201 L205 I209 W249 F253
BS06	PHO	d	A41 V45 W48 G118 F125 Q129 F146 P149 F153 F173 G174 L279	A37 V41 W44 G114 F121 Q125 F142 P145 F149 F169 G170 L275
BS07	CLA	d	F120 I123 M126 L127 F130	F116 I119 M122 L123 F126
BS08	CLA	d	W48 P149 V152 V156 F181 I182 F185 Q186 W191 T192 H197 V201 V204 L279 S282 A283 V286	W44 P145 V148 V152 F177 I178 F181 Q182 W187 T188 H193 V197 V200 L275 S278 A279 V282
BS09	CLA	d	C40 F43 F91 V92 W93 A112 F113 H117 F120	C36 F39 F87 V88 W89 A108 F109 H113 F116

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009507	chloroplast
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7pi5, PDBe:7pi5, PDBj:7pi5
PDBsum	7pi5
PubMed	36799903
UniProt	A0A1C8XRK9

[Back to BioLiP]