Structure of PDB 7p7s Chain d

Receptor sequence

>7p7sd (length=205) Species: 1351 (Enterococcus faecalis) [Search protein sequence]

GQKVHPIGMRVGIIRDWDAKWYAEKEYAEFLHEDLRIRKFIATKLADAAV
STIEIERAANRVNISIHTAKPGMVIGKGGSEVENLRKELNKLTGKRVHIN
IVEIKKPDLDAKLVGEGIARQLENRVAFRRAQKQAIQRAMRAGAKGIKTQ
VSGRLNGADIARSEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWI
YRGEI

3D structure

PDB

7p7s Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	d	G2 Q3 K4 V5 M10 I14 K26 K92 R126 S153 R155 D160 I161 A162 T171 P173 L174 H175 T176 L177 R178 W185 E187 T191 Y192 G193 K194 G196 K198	G1 Q2 K3 V4 M9 I13 K25 K91 R125 S152 R154 D159 I160 A161 T170 P172 L173 H174 T175 L176 R177 W184 E186 T190 Y191 G192 K193 G195 K197

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7p7s, PDBe:7p7s, PDBj:7p7s
PDBsum	7p7s
PubMed	35387982
UniProt	A0A1B4XKR8

[Back to BioLiP]