Structure of PDB 7ood Chain d

Receptor sequence
>7oodd (length=175) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
NLKAHYQKTIAKELQKSFAFSSIMQVPRLEKIVINMGVGDAIRDSKFLES
ALNELHLISGQKPVATKAKNAISTYKLRAGQLIGCKVTLRGERMWAFLEK
LIYVALPRVRDFRGLSLKSFDGRGNYTIGIKEQIIFPEIVYDDIKRIRGF
DVTLVTSTNKDSEALALLRALNLPL
3D structure
PDB7ood Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chaind
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna d K33 N37 M38 G39 G41 T76 Y77 K88 S121 D123 R125 N127 T129 I132 K133 G151 F152 D153 K31 N35 M36 G37 G39 T74 Y75 K86 S119 D121 R123 N125 T127 I130 K131 G149 F150 D151
BS02 rna d S24 M26 Q27 Q63 K64 V66 T90 R92 S22 M24 Q25 Q61 K62 V64 T88 R90
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ood, PDBe:7ood, PDBj:7ood
PDBsum7ood
PubMed36171285
UniProtQ50306|RL5_MYCPN Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]