Structure of PDB 7mt3 Chain d

Receptor sequence

>7mt3d (length=200) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]

ARYTGPVTRKSRRLRTDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQLQ
EKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRAG
LARTRRMARQLVSHGHFNVNGVHVNVPSYRVSQYDIVDVRDKSLNTVPFQ
IARETAGERPIPSWLQVVGERQRVLIHQLPERAQIDVPLTEQLIVEYYSK

3D structure

PDB

7mt3 Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	d	A2 R3 P7 V8 T9 R10 R13 R14 K28 R29 Y31 G34 H36 Q54 M63 E64 K65 Q66 R69 R76 T105 R107 M108 R110 Q111 S114 H115 H117 V125 N126 V127 P128 S129 Y130 K143 T147 P149 E197 S200 K201	A1 R2 P6 V7 T8 R9 R12 R13 K27 R28 Y30 G33 H35 Q53 M62 E63 K64 Q65 R68 R75 T104 R106 M107 R109 Q110 S113 H114 H116 V124 N125 V126 P127 S128 Y129 K142 T146 P148 E196 S199 K200

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005886	plasma membrane
GO:0009274	peptidoglycan-based cell wall
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7mt3, PDBe:7mt3, PDBj:7mt3
PDBsum	7mt3
PubMed	35064151
UniProt	P9WH35\|RS4_MYCTU Small ribosomal subunit protein uS4 (Gene Name=rpsD)

[Back to BioLiP]