Structure of PDB 7dxa Chain d

Receptor sequence

>7dxad (length=339) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]

GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHG
LASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWT
FIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPL
GQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCA
IHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFS
NKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFE
TFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNA

3D structure

PDB

7dxa Structural insights into cyanobacterial photosystem II intermediates associated with Psb28 and Tsl0063.

Chain

Resolution

3.14 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	d	Y42 L49 T50 T53 F54 Y67 L68	Y30 L37 T38 T41 F42 Y55 L56
BS02	CLA	d	F157 V175 I178 L182	F145 V163 I166 L170
BS03	PHO	d	L205 A208 L209 I213 W253	L193 A196 L197 I201 W241
BS04	PHO	d	W48 G118 F125 N142 A145 F146 P149 F173 L279	W36 G106 F113 N130 A133 F134 P137 F161 L267
BS05	CLA	d	F120 I123 M126	F108 I111 M114
BS06	CLA	d	M198 V201 A202 L205 G206	M186 V189 A190 L193 G194
BS07	FE2	d	H214 E241 H268	H202 E229 H256
BS08	CLA	d	V152 V156 F181 L182 F185 W191 H197 G200 V201 V204 L279 S282 A283 V286	V140 V144 F169 L170 F173 W179 H185 G188 V189 V192 L267 S270 A271 V274
BS09	CLA	d	C40 L43 L91 L92 W93 T112 F113 H117	C28 L31 L79 L80 W81 T100 F101 H105

Gene Ontology

	Molecular Function
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009523	photosystem II
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7dxa, PDBe:7dxa, PDBj:7dxa
PDBsum	7dxa
PubMed	34226692
UniProt	D0VWR8\|PSBD_THEVL Photosystem II D2 protein (Fragment) (Gene Name=psbD)

[Back to BioLiP]