Structure of PDB 6zce Chain d

Receptor sequence
>6zced (length=62) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
PVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTSRTIVRNVKGPVRENDILV
LMESEREARRLR
3D structure
PDB6zce A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
Chaind
Resolution5.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna d S21 R22 G23 P47 S16 R17 G18 P42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000054 ribosomal subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0030490 maturation of SSU-rRNA
GO:1900153 positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zce, PDBe:6zce, PDBj:6zce
PDBsum6zce
PubMed33289941
UniProtP0C0X0|RS28B_YEAST Small ribosomal subunit protein eS28B (Gene Name=RPS28B)

[Back to BioLiP]