Structure of PDB 6ppk Chain d

Receptor sequence
>6ppkd (length=43) Species: 1423 (Bacillus subtilis) [Search protein sequence]
KRTFQPNNRKRSKVHGFRSRMSSKNGRLVLARRRRKGRKVLSA
3D structure
PDB6ppk Structural consequences of the interaction of RbgA with a 50S ribosomal subunit assembly intermediate.
Chaind
Resolution4.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna d R3 T4 F5 Q6 P7 N8 N9 R10 K11 R12 S13 K14 V15 H16 G17 F18 R19 R21 K25 N26 A32 R33 R34 R35 R36 K37 R39 K40 L42 R2 T3 F4 Q5 P6 N7 N8 R9 K10 R11 S12 K13 V14 H15 G16 F17 R18 R20 K24 N25 A31 R32 R33 R34 R35 K36 R38 K39 L41
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ppk, PDBe:6ppk, PDBj:6ppk
PDBsum6ppk
PubMed31665744
UniProtP05647|RL34_BACSU Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]