Structure of PDB 6oig Chain d

Receptor sequence
>6oigd (length=109) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
LKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVRLAP
ELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVASAKG
LQTVVVEED
3D structure
PDB6oig An open interface in the pre-80S ribosome coordinated by ribosome assembly factors Tsr1 and Dim1 enables temporal regulation of Fap7.
Chaind
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna d T71 H75 K76 R77 H79 G80 F83 K84 K92 R108 L109 A110 P111 N114 Q115 W118 R120 G121 V122 K123 Y127 R128 K160 G161 L162 Q163 T164 T10 H14 K15 R16 H18 G19 F22 K23 K31 R47 L48 A49 P50 N53 Q54 W57 R59 G60 V61 K62 Y66 R67 K99 G100 L101 Q102 T103
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006450 regulation of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6oig, PDBe:6oig, PDBj:6oig
PDBsum6oig
PubMed33219089
UniProtP0C2H8|RL31A_YEAST Large ribosomal subunit protein eL31A (Gene Name=RPL31A)

[Back to BioLiP]